Perl.com 
 Published on Perl.com http://www.perl.com/pub/a/2001/11/16/perlbio2.html
See this if you're having trouble printing code examples

 

Parsing Protein Domains with Perl
By James D. Tisdall
November 16, 2001

The Perl programming language is popular with biologists because of its practicality. In my book, Beginning Perl for Bioinformatics, I demonstrate how many of the things biologists want to write programs for are readily--even enjoyably--accomplished with Perl.

My book teaches biologists how to program in Perl, even if they have never programmed before. This article will use Perl at the level found in the middle-to-late chapters in my book, after some of the basics have been learned. However, this article can be read by biologists who do not (yet) know any programming. They should be able to skim the program code in this article, only reading the comments, to get a general feel for how Perl is used in practical applications, using real biological data.

Biological data on computers tends to be either in structured ASCII flat files--that is to say, in plain-text files--or in relational databases. Both of these data sources are easy to handle with Perl programs. For this article, I will discuss one of the flat-file data sources, the Prosite database, which contains valuable biological information about protein domains. I will demonstrate how to use Perl to extract and use the protein domain information. In Beginning Perl for Bioinformatics I also show how to work with several other similar data sources, including GenBank (Genetic Data Bank), PDB (Protein DataBank), BLAST (Basic Local Alignment Search Tool) output files, and REBASE (Restriction Enzyme Database).

What is Prosite?

Related Reading

Beginning Perl for BioinformaticsBeginning Perl for Bioinformatics
By James Tisdall
Table of Contents
Index
Sample Chapter
Full Description

Prosite stands for "A Dictionary of Protein Sites and Patterns." To learn more about the fascinating biology behind Prosite, visit the Prosite User Manual. Here's an introductory description of Prosite from the user manual:

"Prosite is a method of determining what is the function of uncharacterized proteins translated from genomic or cDNA sequences. It consists of a database of biologically significant sites and patterns formulated in such a way that with appropriate computational tools it can rapidly and reliably identify to which known family of protein (if any) the new sequence belongs."

In some cases, the sequence of an unknown protein is too distantly related to any protein of known structure to detect its resemblance by overall sequence alignment. However, it can be identified by the occurrence in its sequence of a particular cluster of residue types, variously known as a pattern, a motif, a signature, or a fingerprint. These motifs arise because of particular requirements on the structure of specific regions of a protein, which may be important, for example, for their binding properties, or for their enzymatic activity.

Prosite is available as a set of plain-text files that provide the data, plus documentation. The Prosite home page provides a user interface that allows you to query the database and examine the documentation. The database can also be obtained for local installation from the Prosite ftp site. Its use is free of charge for noncommercial users.

There is some fascinating and important biology involved here; and in the programs that follow there are interesting and useful Perl programming techniques. See the Prosite User Manual for the biology background, and Beginning Perl for Bioinformatics for the programming background. Or just keep reading to get a taste for what is possible when you combine programming skills with biological data.

Prosite Data

The Prosite data can be downloaded to your computer. It is in the ASCII flat file called prosite.dat and is more than 4MB in size. A small version of this file created for this article, called prosmall.dat, is available here. This version of the data has just the first few records from the complete file, making it easier for you to download and test, and it's the file that we'll use in the code discussed later in this article.

Prosite also provides an accompanying data file, prosite.doc, which contains documentation for all the records in prosite.dat. Though we will not use it for this article, I do recommend you look at it and think about how to use the information along with the code presented here if you plan on doing more with Prosite.


O'Reilly Bioinformatics Technology Conference James Tisdall will be speaking at O'Reilly's first Bioinformatics Technology Conference, January 28-31, 2002, in Tuscon, Arizona. For more information visit Bioinformatics Conference Web site.


The Prosite data in prosite.dat (or our much smaller test file prosmall.dat) is organized in "records," each of which consists of several lines, and which always include an ID line and a termination line containing "//". The Prosite lines all begin with a two-character code that specifies the kind of data that appears on that line. Here's a breakdown of all the possible line types that a record may contain from the Prosite User Manual:

ID
Identification (Begins each entry; one per entry)
AC
Accession number (one per entry)
DT
Date (one per entry)
DE
Short description (one per entry)
PA
Pattern (>=0 per entry)
MA
Matrix/profile (>=0 per entry)
RU
Rule (>=0 per entry)
NR
Numerical results (>=0 per entry)
CC
Comments (>=0 per entry)
DR
Cross references to SWISS-PROT (>=0 per entry)
3D
Cross references to PDB (>=0 per entry)
DO
Pointer to the documentation file (one per entry)
//
Termination line (Ends each entry; one per entry)

Each of these line types has certain kinds of information that are formatted in a specific manner, as is detailed in the Prosite documentation.

Prosite Patterns

Let's look specifically at the Prosite patterns. These are presented in a kind of mini-language that describes a set of short stretches of protein that may be a region of known biological activity. Here's the description of the pattern "language" from the Prosite User Manual:

The PA (PAttern) lines contains the definition of a Prosite pattern. The patterns are described using the following conventions:

Perl Subroutine to Translate Prosite Patterns into Perl Regular Expressions

In order to use this pattern data in our Perl program, we need to translate the Prosite patterns into Perl regular expressions, which are the main way that you search for patterns in data in Perl. For the sake of this article I will assume that you know the basic regular expression syntax. (If not, just read the program comments, and skip the Perl regular expressions.) As an example of what the following subroutine does, it will translate the Prosite pattern [AC]-x-V-x(4)-{ED}. into the equivalent Perl regular expression [AC].V.{4}[^ED]

Here, then, is our first Perl code, the subroutine PROSITE_2_regexp, to translate the Prosite patterns to Perl regular expressions:


#
# Calculate a Perl regular expression
#  from a PROSITE pattern
#
sub PROSITE_2_regexp {

  #
  # Collect the PROSITE pattern
  #
  my($pattern) = @_;

  #
  # Copy the pattern to a regular expression
  #
  my $regexp = $pattern;

  #
  # Now start translating the pattern to an
  #  equivalent regular expression
  #

  #
  # Remove the period at the end of the pattern
  #
  $regexp =~ s/.$//;

  #
  # Replace 'x' with a dot '.'
  #
  $regexp =~ s/x/./g;

  #
  # Leave an ambiguity such as '[ALT]' as is.
  #   However, there are two patterns [G>] that need
  #   special treatment (and the PROSITE documentation
  #   is a bit vague, perhaps).
  #
  $regexp =~ s/\[G\>\]/(G|\$)/;
  
  #
  # Ambiguities such as {AM} translate to [^AM].
  #
  $regexp =~ s/{([A-Z]+)}/[^$1]/g;

  #
  # Remove the '-' between elements in a pattern
  #
  $regexp =~ s/-//g;

  #
  # Repetitions such as x(3) translate as x{3}
  #
  $regexp =~ s/\((\d+)\)/{$1}/g;

  #
  # Repetitions such as x(2,4) translate as x{2,4}
  #
  $regexp =~ s/\((\d+,\d+)\)/{$1}/g;

  #
  # '<' becomes '^' for "beginning of sequence"
  #
  $regexp =~ s/\</^/;

  #
  # '>' becomes '$' for "end of sequence"
  #
  $regexp =~ s/\>/\$/;

  #
  # Return the regular expression
  #
  return $regexp;
}

Subroutine PROSITE_2_regexp takes the Prosite pattern and translates its parts step by step into the equivalent Perl regular expression, as explained in the comments for the subroutine. If you do not know Perl regular expression syntax at this point, just read the comments--that is, the lines that start with the # character. That will give you the general idea of the subroutine, even if you don't know any Perl at all.


Learn more about the power of regular expressions from O'Reilly's Mastering Regular Expressions: Powerful Techniques for Perl and Other Tools.


by James D. Tisdall

Perl Subroutine to Parse Prosite Records into Their Line Types

The other task we need to accomplish is to parse the various types of lines, so that, for instance, we can get the ID and the PA pattern lines easily. The next subroutine accomplishes this task: given a Prosite record, it returns a hash with the lines of each type indexed by a key that is the two-character "line type". The keys we'll be interested in are the ID key for the line that has the identification information; and the PA key for the line(s) that have the pattern information.

This "get_line_types" subroutine does more than we need. It makes a hash index on all the line types, not just the ID and PA lines that we'll actually use here. But that's OK. The subroutine is short and simple enough, and we may want to use it later to do things with some of the other types of lines in a Prosite record.

By building our hash to store the lines of a record, we can extract any of the data lines from the record that we like, just by giving the line type code (such as ID for identification number). We can use this hash to extract two line types that will interest us here, the ID identifier line and the PA pattern line. Then, by translating the Prosite pattern into a Perl regular expression (using our first subroutine), we will be in a position to actually look for all the patterns in a protein sequence. In other words, we will have extracted the pattern information and made it available for use in our Perl program, so we can search for the patterns in the protein sequence.


If you're interested in learning Perl, don't miss O'Reilly's best-selling Learning Perl, 3rd Edition, which has been updated to cover Perl version 5.6 and rewritten to reflect the needs of programmers learning Perl today. For a complete list of O'Reilly's books on Perl, go to perl.oreilly.com.


Here, then, is our second subroutine, which accepts a Prosite record, and returns a hash which has the lines of the record indexed by their line types:


#
# Parse a PROSITE record into "line types" hash
# 
sub get_line_types {

  #
  # Collect the PROSITE record
  #
  my($record) = @_;

  #
  # Initialize the hash
  #   key   = line type
  #   value = lines
  #
  my %line_types_hash = ();

  #
  # Split the PROSITE record to an array of lines
  #
  my @records = split(/\n/,$record);

  #
  # Loop through the lines of the PROSITE record
  #
  foreach my $line (@records) {

    #
    # Extract the 2-character name
    # of the line type
    #
    my $line_type = substr($line,0,2);

    #
    # Append the line to the hash
    # indexed by this line type
    #
    (defined $line_types_hash{$line_type})
    ?  ($line_types_hash{$line_type} .= $line)
    :  ($line_types_hash{$line_type} = $line);
  }

  #
  # Return the hash 
  #
  return %line_types_hash;
}

Main Program

Now let's see the code at work. The following program uses the subroutines we've just defined to read in the Prosite records one at a time from the database in the flat file prosmall.txt. It then separates the different kinds of lines (such as "PA" for pattern), and translates the patterns into regular expressions, using the subroutine PROSITE_2_regexp we already wrote. Finally, it searches for the regular expressions in the protein sequence, and reports the position of the matched pattern in the sequence.


#!/usr/bin/perl
#
# Parse patterns from the PROSITE database, and
# search for them in a protein sequence
#

#
# Turn on useful warnings and constraints
#
use strict;
use warnings;

#
# Declare variables
#

#
# The PROSITE database
#
my $prosite_file = 'prosmall.dat';

#
# A "handle" for the opened PROSITE file
#
my $prosite_filehandle; 

#
# Store each PROSITE record that is read in
#
my $record = '';

#
# The protein sequence to search
# (use "join" and "qw" to keep line length short)
#
my $protein = join '', qw(
MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSG
QSTVSGELQDSVLQDRSMPHQEILAADEVLQESE
MRQQDMISHDELMVHEETVKNDEEQMETHERLPQ
);

#
# open the PROSITE database or exit the program
#
open($prosite_filehandle, $prosite_file)
 or die "Cannot open PROSITE file $prosite_file";

#
# set input separator to termination line //
#
$/ = "//\n";

#
# Loop through the PROSITE records
#
while($record = <$prosite_filehandle>) {

  #
  # Parse the PROSITE record into its "line types"
  #
  my %line_types = get_line_types($record);

  #
  # Skip records without an ID (the first record)
  #
  defined $line_types{'ID'} or next;

  #
  # Skip records that are not PATTERN
  # (such as MATRIX or RULE)
  #
  $line_types{'ID'} =~ /PATTERN/ or next;

  #
  # Get the ID of this record
  #
  my $id = $line_types{'ID'};
  $id =~ s/^ID   //;
  $id =~ s/; .*//;

  #
  # Get the PROSITE pattern from the PA line(s)
  #
  my $pattern = $line_types{'PA'};
  # Remove the PA line type tag(s)
  $pattern =~ s/PA   //g;

  #
  # Calculate the Perl regular expression
  # from the PROSITE pattern
  #
  my $regexp =  PROSITE_2_regexp($pattern);

  #
  # Find the PROSITE regular expression patterns
  # in the protein sequence, and report
  #
  while ($protein =~ /$regexp/g) {
    my $position = (pos $protein) - length($&) +1;
    print "Found $id at position $position\n";
    print "   match:   $&\n";
    print "   pattern: $pattern\n";
    print "   regexp:  $regexp\n\n";
  }
}

#
# Exit the program
#
exit;

This program is available online as the file parse_prosite. The tiny example Prosite database is available as the file prosmall.dat. If you save these files on your (Unix, Linux, Macintosh, or Windows) computer, you can enter the following command at your command-line prompt (in the same folder in which you saved the two files):


% perl parse_prosite

and it will produce the following output:


Found PKC_PHOSPHO_SITE at position 22
   match:   SSR
   pattern: [ST]-x-[RK].
   regexp:  [ST].[RK]

Found PKC_PHOSPHO_SITE at position 86
   match:   TVK
   pattern: [ST]-x-[RK].
   regexp:  [ST].[RK]

Found CK2_PHOSPHO_SITE at position 76
   match:   SHDE
   pattern: [ST]-x(2)-[DE].
   regexp:  [ST].{2}[DE]

Found MYRISTYL at position 30
   match:   GGVSGQ
   pattern: G-{EDRKHPFYW}-x(2)-[STAGCN]-{P}.
   regexp:  G[^EDRKHPFYW].{2}[STAGCN][^P]

As you see, our short program goes through the Prosite database one record at a time, parsing each record according to the types of lines within it. If the record has an ID and a pattern, it then extracts them, creates a Perl regular expression from the pattern, and finally searches in a protein sequence for the regular expression, reporting on the patterns found.

The Next Step

This article has shown you how to take biological data from the Prosite database and use it in your own programs. With this ability, you can write programs specific to your particular research needs.

Many kinds of data discovery are possible: you could combine searches for Prosite patterns with some other computation. For instance, you may want to also search the associated genomic DNA or cDNA for restriction sites surrounding a particular Prosite pattern in the translated protein, in preparation for cloning.


James Tisdall has also written Why Biologists Want to Program Computers for oreilly.com.


While such programs are interesting in their own right, their importance in laboratory research really lies in the fact that their use can save enormous amounts of time; time which can then be used for other, less routine, tasks on which biological research critically depends.

This article gives an example of using Perl to extract and use data from a flat file database, of which there are many in biological research. In fact, some of the most important biological databases are in flat file format, including GenBank and PDB, the primary databases for DNA sequence information and for protein structures.

With the ability to write your own programs, the true power of bioinformatics can be applied in your lab. Learning the Perl programming language can give you a direct entry into this valuable new laboratory technique.


O'Reilly & Associates recently released (October 2001) Beginning Perl for Bioinformatics.

Perl.com Compilation Copyright © 1998-2006 O'Reilly Media, Inc.